PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000258212
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family WRKY
Protein Properties Length: 562aa    MW: 61164.6 Da    PI: 9.5206
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000258212genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY107.18.5e-34243299259
                    --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    dDgynWrKYGqK+vkgsefprsYY+Ct++ Cpvkkkvers  d++++ei+Y+geHnhe
  MDP0000258212 243 DDGYNWRKYGQKQVKGSEFPRSYYKCTHPXCPVKKKVERSV-DGQITEIIYKGEHNHE 299
                    8****************************************.***************8 PP

2WRKY106.71.2e-33417475159
                    ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
           WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                    ldDgy+WrKYGqK+vkg+++prsYY+Ct++ C+v+k++er+++dpk+v++tYeg+Hnh+
  MDP0000258212 417 LDDGYRWRKYGQKVVKGNPYPRSYYKCTFPACNVRKHIERASTDPKAVITTYEGKHNHD 475
                    59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.808.3E-30236301IPR003657WRKY domain
PROSITE profilePS5081124.352237301IPR003657WRKY domain
SuperFamilySSF1182906.93E-26241301IPR003657WRKY domain
SMARTSM007746.7E-37242300IPR003657WRKY domain
PfamPF031064.3E-26243299IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.5E-36402477IPR003657WRKY domain
SuperFamilySSF1182907.19E-29409477IPR003657WRKY domain
PROSITE profilePS5081137.344412477IPR003657WRKY domain
SMARTSM007741.9E-38417476IPR003657WRKY domain
PfamPF031062.7E-25418475IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 562 aa     Download sequence    Send to blast
MADNQGQPPG PLPPGSSQPS KPAATHDPPR PTITLPPRTS FESIFSSGAG GNTGPGLGMG  60
FSPGPMTLVS NFFSDGDDCK SFSQLLAGAM TSPSPREPGF PQLEKRNSGD NDGGSEFRFK  120
QNRXPPMFSV PTPSGFLDSP GIFSPGQGPF GMTHQQALAQ VTAQAAALSP SFFNFSTEFS  180
TTFSTAPATS LTQPPSLXSD TMPPQEIPSG TPDSAVATKE SSDIALSDQR SQPSSFAVDK  240
PNDDGYNWRK YGQKQVKGSE FPRSYYKCTH PXCPVKKKVE RSVDGQITEI IYKGEHNHER  300
PXSKRGKDPN ANSQANSDLA LQVHGGNSNK SKDGTGPYSM SKKRQESSQA THDNLSGTSD  360
SEEVGDAETR VGEKDEDQPD TKRRNTEVRX ELAPASAHRT VTEPRIIVQT TSEVDLLDDG  420
YRWRKYGQKV VKGNPYPRSY YKCTFPACNV RKHIERASTD PKAVITTYEG KHNHDVPASK  480
TSGHYTGNNN ASNLRSVNPG TGKMDKIDLR NKDQQPIARK QARGIREWKI STKQAKVVSV  540
TFARICFSLQ AVVLIKAQFP NR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A1e-41243478878Probable WRKY transcription factor 4
1wj2_A1e-41243478878Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00260DAPTransfer from AT2G03340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008352971.10.0PREDICTED: probable WRKY transcription factor 3
SwissprotQ9ZQ701e-166WRKY3_ARATH; Probable WRKY transcription factor 3
TrEMBLM5XF340.0M5XF34_PRUPE; Uncharacterized protein
STRINGVIT_01s0011g00220.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF154534100
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03340.11e-150WRKY DNA-binding protein 3